PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624418.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 301aa    MW: 33054.1 Da    PI: 6.6846
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624418.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.61.2e-29167223158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy+rIl+RRq+Rak+e ekk  +k+rkpylheSRh+hAlrR+R+sgGrF
  XP_009624418.1 167 QEPVYVNAKQYRRILQRRQSRAKAELEKKQ-IKARKPYLHESRHQHALRRARASGGRF 223
                     69************************9999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.1E-32165226IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.8166226IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.3E-25168223IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.8E-23169191IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.8E-23200223IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MPSNTKSANR EEPNAYDGPR SAVYSEPWWN STGYNPVSPG LTRGTASDSS SLEQSMDGQS  60
QSDGINEEEE DAPEKSQSII PLHADGSYGQ ADQNFQPAAP TIPPKLDGTL TQTQQLELVG  120
HSIACAPNPY VDPYYGGMMT AFGQPLVPPH VLDMHYARMP LPHEMAQEPV YVNAKQYRRI  180
LQRRQSRAKA ELEKKQIKAR KPYLHESRHQ HALRRARASG GRFAKKTDAD ASKGTGSVSS  240
SGSEPLQFNA ADIQNRHENG RLAELQHSYS NGSSYGNQSS FQESKDEYQS AESREGGSSG  300
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-17167231266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0141460.0BT014146.1 Lycopersicon esculentum clone 133265F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624416.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_009624418.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLA0A0V0IR830.0A0A0V0IR83_SOLCH; Putative nuclear transcription factor Y subunit A-1-like
STRINGPGSC0003DMT4000189580.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.37e-55nuclear factor Y, subunit A1